Solution Engineer, ValueOps

Broadcom

Confirmed live today High trust
Remote

Quick summary

Work type
Remote
Location
WAOHBoston, MAKYCTVTRIMSLADEMOTNINWIVAOKTXNYNJSCNHNCMNMIWVKSMDILIAPANEGADCFL
Salary
$132,200–$211,500 / yr
Employment
Full-time
Posted
29 days ago
Freshness
Confirmed live today
Closes
Jan 13, 2027

Market check

Salary context

Competitive pay

How this pay compares to similar roles

Similar $158k
This role $172k
$102k most similar roles pay here $223k

This role pays more than 65% of similar roles. Most pay $126,800–$188,924 — the shaded band above. At the midpoint, this role pays about $172k versus about $158k for comparable roles.

Based on 240 similar postings.

Employer

About Broadcom

Broadcom is a global semiconductor and infrastructure software company that designs and markets a wide range of networking, storage, and wireless connectivity solutions. Industry: Semiconductors & Infrastructure Software

Broadcom currently has 172 open roles on FindRole.

Listed pay typically runs $121,900–$195,000 across 125 roles with salary data.

Most-posted roles

View all roles at Broadcom

At a glance

TL;DR · Solution Engineer, ValueOps

Solution Engineer - ValueOps joins the Solution Engineering team to serve as a Domain Specialist focused on helping enterprise customers achieve business outcomes through portfolio management and agile management solutions. The role involves performing value alignment, building relationships across IT and business silos, and translating complex requirements into specific systems or process designs. Day-to-day responsibilities include conducting demonstrations, performing proof of value, managing adoption activities, and presenting solution roadmaps to stakeholders. Candidates must possess expertise in Project and Portfolio Management, FinOps, Infrastructure Portfolio Management, and Agile frameworks like SAFe. The role requires proficiency with tools such as Clarity, Planview, Jira, ServiceNow, and Apptio. This position addresses the challenge of transforming operating models for large organizations by providing software solutions that improve agility, innovation, and operational excellence within complex technology environments.

What you'll do

  • Translate complex customer business requirements into specific system, application, or process designs.
  • Perform value alignment with strategic customers to ensure they achieve desired business outcomes.
  • Build and document knowledge of customer portfolio management, agile transformations, and project impacts.
  • Act as a key resource during the early decision-making stages of the customer's lifecycle.
  • Lead adoption activities and manage account opportunity and engagement information for large enterprise clients.
  • Perform product demonstrations and provide proof of value for PPM and Agile solutions.
  • Present solution and adoption roadmaps to customers to drive long-term engagement.
  • Collaborate with internal teams across Sales, R&D, and Services to ensure consistent solution architecture.

What we're looking for

  • Hold a Bachelor's degree and 17+ years of related experience, or a Master's degree and 15+ years of related experience.
  • Strong background in Project & Portfolio Management, FinOps, Infrastructure Portfolio Management, and Agile management solutions.
  • Experience with tools such as Clarity, Planview, Jira, ServiceNow, and Apptio.
  • Understanding of Agile frameworks, such as SAFe.
  • Ability to translate customer business requirements into specific systems, applications, or process designs for complex technology solutions.
  • Strong presentation skills, including the ability to perform software demonstrations and proof of value.
  • Excellent interpersonal and communication skills to interact with business users and document requirements.

More like this

Similar roles

Solution Engineer

Intapp

Charlotte, NC 1 day ago
Boomi Intapp SOAP REST SQL Python Java C# SaaS Visio Business Process Review Design Review Data Security
5+ yrs exp Hybrid

Solution Engineer, AI Workforce

Microsoft

42 days ago $86,100–$169,800
Microsoft 365 Copilot Copilot Studio Azure Virtual Desktop Windows 365 Intune Entra ID Microsoft 365 Azure Power BI Cloud Native Management Proof of Concept Solution Design Information Security Architecture
2+ yrs exp Hybrid

Solutions Engineer

Siemens Healthineers

Remote 7 days ago $117,770–$161,931
Kubernetes Linux Windows Server AWS Azure GCP Oracle PostgreSQL SQL DICOM HL7 Python Bash PowerShell Ansible Networking Security
Remote

Solutions Engineer

Motorola Solutions

Remote (Richardson, TX) +1 57 days ago $85,000–$100,000
SaaS HaaS Wi-Fi IP Networking APIs Cybersecurity Data Privacy Integration Technical Sales presales Solutions Consulting
4+ yrs exp Remote

Solutions Engineer

Apex

Austin, TX 67 days ago $89,091–$111,364
REST APIs Java Python C# C++ Go AWS GCP Docker Kubernetes Apache Kafka AWS Kinesis Google Pub/Sub Microservices Cloud Infrastructure DevOps Monitoring Tools
2+ yrs exp Hybrid

Solution Engineer, AI Business Process

Microsoft

13 days ago $86,100–$169,800
Artificial Intelligence Azure Power Platform Dynamics 365 Office 365 Power BI Solution Design Proof of Concept Architecture Information Security
2+ yrs exp